OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

POU6F1 (NM_002702) Human Mass Spec Standard

Be the first to review this product
SKU
PH308598
POU6F1 MS Standard C13 and N15-labeled recombinant protein (NP_002693)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA329280 Rabbit Polyclonal anti-POU6F1 antibody
100 ul
$585.00
LY419157 Transient overexpression lysate of POU class 6 homeobox 1 (POU6F1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "POU6F1 or NM_002702"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208598
Predicted MW 32.6 kDa
Protein Sequence
Protein Sequence
>RC208598 protein sequence
Red=Cloning site Green=Tags(s)

MPGISSQILTNAQGQVIGTLPWVVNSASVAAPAPAQSLQVQAVTPQLLLNAQGQVIATLASSPLPPPVAV
RKPSTPESPAKSEVQPIQPTPTVPQPAVVIASPAPAAKPSASAPIPITCSETPTVSQLVSKPHTPSLDED
GINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLN
EAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRV
WFCNRRQTLKNTSKLNVFQIP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002693
RefSeq Size 4715
RefSeq ORF 903
Synonyms BRN5; MPOU; TCFB1
Locus ID 5463
UniProt ID Q14863
Cytogenetics 12q13.13
Summary Transcription factor that binds preferentially to a variant of the octamer motif (5'-ATGATAAT-3').UniProtKB/Swiss-Prot Function
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "POU6F1" proteins (3)
SKU Description Size Price
LC419157 Lyophilized POU6F1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419157 Transient overexpression lysate of POU class 6 homeobox 1 (POU6F1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP308598 Recombinant protein of human POU class 6 homeobox 1 (POU6F1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products