POU6F1 (NM_002702) Human Mass Spec Standard

CAT#: PH308598

POU6F1 MS Standard C13 and N15-labeled recombinant protein (NP_002693)

Product Images

Coomassie blue staining of purified POU6F1 protein (Cat# TP308598). The protein was produced from HEK293T cells transfected with POU6F1 cDNA clone (Cat# RC208598) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208598
• Predicted MW: 32.6 kDa
• Protein Sequence:
  Sequence Link

  >RC208598 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPGISSQILTNAQGQVIGTLPWVVNSASVAAPAPAQSLQVQAVTPQLLLNAQGQVIATLASSPLPPPVAV
  RKPSTPESPAKSEVQPIQPTPTVPQPAVVIASPAPAAKPSASAPIPITCSETPTVSQLVSKPHTPSLDED
  GINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLN
  EAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRV
  WFCNRRQTLKNTSKLNVFQIP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002693
• RefSeq Size: 4715
• RefSeq ORF: 903
• Synonyms: BRN5; MPOU; TCFB1
• Locus ID: 5463
• UniProt ID: Q14863
• Cytogenetics: 12q13.13
• Summary: Transcription factor that binds preferentially to a variant of the octamer motif (5'-ATGATAAT-3').[UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors