POU6F1 (NM_002702) Human Recombinant Protein

SKU
TP308598
Recombinant protein of human POU class 6 homeobox 1 (POU6F1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208598 protein sequence
Red=Cloning site Green=Tags(s)

MPGISSQILTNAQGQVIGTLPWVVNSASVAAPAPAQSLQVQAVTPQLLLNAQGQVIATLASSPLPPPVAV
RKPSTPESPAKSEVQPIQPTPTVPQPAVVIASPAPAAKPSASAPIPITCSETPTVSQLVSKPHTPSLDED
GINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLN
EAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRV
WFCNRRQTLKNTSKLNVFQIP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002693
Locus ID 5463
UniProt ID Q14863
Cytogenetics 12q13.13
RefSeq Size 4715
RefSeq ORF 903
Synonyms BRN5; MPOU; TCFB1
Summary Transcription factor that binds preferentially to a variant of the octamer motif (5'-ATGATAAT-3').[UniProtKB/Swiss-Prot Function]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:POU6F1 (NM_002702) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308598 POU6F1 MS Standard C13 and N15-labeled recombinant protein (NP_002693) 10 ug
$3,255.00
LC419157 POU6F1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419157 Transient overexpression lysate of POU class 6 homeobox 1 (POU6F1), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.