POU6F1 (NM_002702) Human Mass Spec Standard

SKU
PH308598
POU6F1 MS Standard C13 and N15-labeled recombinant protein (NP_002693)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208598]
Predicted MW 32.6 kDa
Protein Sequence
Protein Sequence
>RC208598 protein sequence
Red=Cloning site Green=Tags(s)

MPGISSQILTNAQGQVIGTLPWVVNSASVAAPAPAQSLQVQAVTPQLLLNAQGQVIATLASSPLPPPVAV
RKPSTPESPAKSEVQPIQPTPTVPQPAVVIASPAPAAKPSASAPIPITCSETPTVSQLVSKPHTPSLDED
GINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLN
EAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRV
WFCNRRQTLKNTSKLNVFQIP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002693
RefSeq Size 4715
RefSeq ORF 903
Synonyms BRN5; MPOU; TCFB1
Locus ID 5463
UniProt ID Q14863
Cytogenetics 12q13.13
Summary Transcription factor that binds preferentially to a variant of the octamer motif (5'-ATGATAAT-3').[UniProtKB/Swiss-Prot Function]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:POU6F1 (NM_002702) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419157 POU6F1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419157 Transient overexpression lysate of POU class 6 homeobox 1 (POU6F1), transcript variant 1 100 ug
$436.00
TP308598 Recombinant protein of human POU class 6 homeobox 1 (POU6F1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.