OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HE4 (WFDC2) (NM_006103) Human Mass Spec Standard

Be the first to review this product
SKU
PH308491
WFDC2 MS Standard C13 and N15-labeled recombinant protein (NP_006094)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA801136 WFDC2 (HE4) mouse monoclonal antibody, clone OTI1E12 (formerly 1E12) 100 ul
$447.00
LY416866 Transient overexpression lysate of WAP four-disulfide core domain 2 (WFDC2) (as WB positive control) 100 ug
$436.00

Other products for "HE4 or NM_006103"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208491
Predicted MW 13 kDa
Protein Sequence
Protein Sequence
>RC208491 protein sequence
Red=Cloning site Green=Tags(s)

MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFC
SLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006094
RefSeq Size 570
RefSeq ORF 372
Synonyms dJ461P17.6; EDDM4; HE4; WAP5
Locus ID 10406
UniProt ID Q14508
Cytogenetics 20q13.12
Summary This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation. provided by RefSeq, Jul 2008
Protein Families Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HE4" proteins (4)
SKU Description Size Price
LC416866 Lyophilized WFDC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416866 Transient overexpression lysate of WAP four-disulfide core domain 2 (WFDC2) (as WB positive control) 100 ug
$436.00
TP308491 Recombinant protein of human WAP four-disulfide core domain 2 (WFDC2), 20 µg 20 ug
$737.00
TP750124 Purified recombinant protein of Human WAP four-disulfide core domain 2 (HE4), N-terminal Trx-HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products