HE4 (WFDC2) (NM_006103) Human Recombinant Protein
SKU
TP308491
Recombinant protein of human WAP four-disulfide core domain 2 (WFDC2), 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC208491 protein sequence
Red=Cloning site Green=Tags(s) MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFC SLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_006094 |
Locus ID | 10406 |
UniProt ID | Q14508 |
Cytogenetics | 20q13.12 |
RefSeq Size | 570 |
RefSeq ORF | 372 |
Synonyms | dJ461P17.6; EDDM4; HE4; WAP5 |
Summary | This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein, Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH308491 | WFDC2 MS Standard C13 and N15-labeled recombinant protein (NP_006094) | 10 ug |
$3,255.00
|
|
LC416866 | WFDC2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY416866 | Transient overexpression lysate of WAP four-disulfide core domain 2 (WFDC2) | 100 ug |
$436.00
|
|
TP750124 | Purified recombinant protein of Human WAP four-disulfide core domain 2 (HE4), N-terminal Trx-HIS tag, expressed in E. coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.