OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CELF3 (NM_007185) Human Mass Spec Standard

Be the first to review this product
SKU
PH308465
CELF3 MS Standard C13 and N15-labeled recombinant protein (NP_009116)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY416136 Transient overexpression lysate of trinucleotide repeat containing 4 (TNRC4) (as WB positive control) 100 ug
$436.00

Other products for "CELF3 or NM_007185"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208465
Predicted MW 50.5 kDa
Protein Sequence
Protein Sequence
>RC208465 protein sequence
Red=Cloning site Green=Tags(s)

MKEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHE
QKTLPGMNRPIQVKPADSESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFV
KFQTHAEAKAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMFSPITLQFGAYSAYTQA
LMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVN
GYSQVPTQPTGQPAPDALYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAYPAAYSLVAPAFPQPPALVA
QQPPPPPQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSK
CFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDANRPY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009116
RefSeq Size 5615
RefSeq ORF 1392
Synonyms BRUNOL1; CAGH4; ERDA4; ETR-1; TNRC4
Locus ID 11189
UniProt ID Q5SZQ8
Cytogenetics 1q21.3
Summary Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Multiple alternatively spliced transcript variants encoding different isoforms have been identified in this gene. provided by RefSeq, Feb 2010
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CELF3" proteins (6)
SKU Description Size Price
LC416136 Lyophilized CELF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433039 Lyophilized CELF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416136 Transient overexpression lysate of trinucleotide repeat containing 4 (TNRC4) (as WB positive control) 100 ug
$436.00
LY433039 Transient overexpression lysate of CUGBP, Elav-like family member 3 (CELF3), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP308465 Recombinant protein of human trinucleotide repeat containing 4 (TNRC4), 20 µg 20 ug
$737.00
TP330039 Purified recombinant protein of Homo sapiens CUGBP, Elav-like family member 3 (CELF3), transcript variant 3, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products