OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IFTAP (NM_138787) Human Mass Spec Standard

Be the first to review this product
SKU
PH308417
C11orf74 MS Standard C13 and N15-labeled recombinant protein (NP_620142)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA340304 Rabbit Polyclonal Anti-C11orf74 Antibody
100 ul
$585.00
LY408524 Transient overexpression lysate of chromosome 11 open reading frame 74 (C11orf74) (as WB positive control) 100 ug
$436.00

Other products for "IFTAP or NM_138787"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208417
Predicted MW 25.4 kDa
Protein Sequence
Protein Sequence
>RC208417 protein sequence
Red=Cloning site Green=Tags(s)

MSAHMSGLEIMDEDQLIKDVLDKFLNCHEQTYDEEFLNTFTHLSQEDHVSKRGVFGTDSSENIFTSAKVT
HKNEADDYHLRNKTIFLRTSSQCLEEQVDNFLDLEDLDMDEEIKPQMSEDLLLLPGEVEQDVSTSIPSCI
PFVAQPPTCEVKPKPSVKRMDKQTEEILGDEVQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRK
DTSPDLEKSCD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_620142
RefSeq Size 911
RefSeq ORF 663
Synonyms C11orf74; HEPIS; NWC
Locus ID 119710
UniProt ID Q86VG3
Cytogenetics 11p12
Summary This gene encodes a protein that was identified as a cellular interacting partner of non-structural protein 10 of the severe acute respiratory syndrome coronavirus (SARS-CoV). The encoded protein may function as a negative regulator of transcription. There is a pseudogene for this gene on chromosome 1. Alternative splicing results in multiple transcript variants. provided by RefSeq, Mar 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IFTAP" proteins (3)
SKU Description Size Price
LC408524 Lyophilized C11orf74 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408524 Transient overexpression lysate of chromosome 11 open reading frame 74 (C11orf74) (as WB positive control) 100 ug
$436.00
TP308417 Recombinant protein of human chromosome 11 open reading frame 74 (C11orf74), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products