OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COMTD1 (NM_144589) Human Mass Spec Standard

Be the first to review this product
SKU
PH308412
COMTD1 MS Standard C13 and N15-labeled recombinant protein (NP_653190)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY408263 Transient overexpression lysate of catechol-O-methyltransferase domain containing 1 (COMTD1) (as WB positive control) 100 ug
$436.00

Other products for "COMTD1 or NM_144589"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208412
Predicted MW 28.8 kDa
Protein Sequence
Protein Sequence
>RC208412 protein sequence
Red=Cloning site Green=Tags(s)

MTQPVPRLSVPAALALGSAALGAAFATGLFLGRRCPPWRGRREQCLLPPEDSRLWQYLLSRSMREHPALR
SLRLLTLEQPQGDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSALALALALPADGRVVTCEVDAQPP
ELGRPLWRQAEAEHKIDLRLKPALETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAV
LRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPLGDGLTLAFKI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_653190
RefSeq Size 1041
RefSeq ORF 786
Locus ID 118881
UniProt ID Q86VU5
Cytogenetics 10q22.2
Summary Putative O-methyltransferase.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "COMTD1" proteins (3)
SKU Description Size Price
LC408263 Lyophilized COMTD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408263 Transient overexpression lysate of catechol-O-methyltransferase domain containing 1 (COMTD1) (as WB positive control) 100 ug
$436.00
TP308412 Recombinant protein of human catechol-O-methyltransferase domain containing 1 (COMTD1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products