OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCL14 (NM_032963) Human Mass Spec Standard

Be the first to review this product
SKU
PH308370
CCL14 MS Standard C13 and N15-labeled recombinant protein (NP_116739)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY409847 Transient overexpression lysate of chemokine (C-C motif) ligand 14 (CCL14), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "CCL14 or NM_032963"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208370
Predicted MW 10.7 kDa
Protein Sequence
Protein Sequence
>RC208370 protein sequence
Red=Cloning site Green=Tags(s)

MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKR
GHSVCTNPSDKWVQDYIKDMKEN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_116739
RefSeq Size 506
RefSeq ORF 279
Synonyms CC-1; CC-3; CKB1; HCC-1; HCC-1(1-74); HCC-1/HCC-3; HCC-3; MCIF; NCC-2; NCC2; SCYA14; SCYL2; SY14
Locus ID 6358
UniProt ID Q16627
Cytogenetics 17q12
Summary This gene, chemokine (C-C motif) ligand 14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Read-through transcripts are also expressed that include exons from the upstream cytokine gene, chemokine (C-C motif) ligand 15, and are represented as GeneID: 348249. provided by RefSeq, Dec 2009
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CCL14" proteins (8)
SKU Description Size Price
PH317672 CCL14 MS Standard C13 and N15-labeled recombinant protein (NP_004157) 10 ug
$3,360.00
LC409847 Lyophilized CCL14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418173 Lyophilized CCL14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409847 Transient overexpression lysate of chemokine (C-C motif) ligand 14 (CCL14), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY418173 Transient overexpression lysate of chemokine (C-C motif) ligand 14 (CCL14), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP308370 Recombinant protein of human chemokine (C-C motif) ligand 14 (CCL14), transcript variant 3, 20 µg 20 ug
$867.00
TP317672 Recombinant protein of human chemokine (C-C motif) ligand 14 (CCL14), transcript variant 1, 20 µg 20 ug
$867.00
TP720662 Purified recombinant protein of Human chemokine (C-C motif) ligand 14 (CCL14), transcript variant 3 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products