OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DGCR6 (NM_005675) Human Mass Spec Standard

Be the first to review this product
SKU
PH308368
DGCR6 MS Standard C13 and N15-labeled recombinant protein (NP_005666)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA368181 DGCR6 rabbit polyclonal antibody
100 ul
$310.00
LY417144 Transient overexpression lysate of DiGeorge syndrome critical region gene 6 (DGCR6) (as WB positive control) 100 ug
$436.00

Other products for "DGCR6 or NM_005675"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208368
Predicted MW 24.8 kDa
Protein Sequence
Protein Sequence
>RC208368 representing NM_005675
Red=Cloning site Green=Tags(s)

MERYAGALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEI
QHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVLQAAQQRELEAVEHRIREEQRAMDQK
IVLELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCWAGKAALGLGGPWQLPAAQ
CDQKGSPVPP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005666
RefSeq Size 1188
RefSeq ORF 660
Locus ID 8214
UniProt ID Q14129
Cytogenetics 22q11
Summary DiGeorge syndrome, and more widely, the CATCH 22 syndrome, are associated with microdeletions in chromosomal region 22q11.2. The product of this gene shares homology with the Drosophila melanogaster gonadal protein, which participates in gonadal and germ cell development, and with the gamma-1 subunit of human laminin. This gene is a candidate for involvement in DiGeorge syndrome pathology and in schizophrenia. provided by RefSeq, Nov 2008
Protein Families Druggable Genome, ES Cell Differentiation/IPS
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DGCR6" proteins (3)
SKU Description Size Price
LC417144 Lyophilized DGCR6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417144 Transient overexpression lysate of DiGeorge syndrome critical region gene 6 (DGCR6) (as WB positive control) 100 ug
$436.00
TP308368 Purified recombinant protein of Homo sapiens DiGeorge syndrome critical region gene 6 (DGCR6), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products