OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PTER (NM_001001484) Human Mass Spec Standard

Be the first to review this product
SKU
PH308362
PTER MS Standard C13 and N15-labeled recombinant protein (NP_001001484)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA813176 PTER mouse monoclonal antibody,clone OTI1G4 100 ul
$447.00
LY410742 Transient overexpression lysate of phosphotriesterase related (PTER), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "PTER or NM_001001484"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208362
Predicted MW 39 kDa
Protein Sequence
Protein Sequence
>RC208362 protein sequence
Red=Cloning site Green=Tags(s)

MSSLSGKVQTVLGLVEPSKLGRTLTHEHLAMTFDCCYCPPPPCQEAISKEPIVMKNLYWIQKNAYSHKEN
LQLNQETEAIKEELLYFKANGGGALVENTTTGISRDTQTLKRLAEETGVHIISGAGFYVDATHSSETRAM
SVEQLTDVLMNEILHGADGTSIKCGIIGEIGCSWPLTESERKVLQATAHAQAQLGCPVIIHPGRSSRAPF
QIIRILQEAGADISKTVMSHLDRTILDKKELLEFAQLGCYLEYDLFGTELLHYQLGPDIDMPDDNKRIRR
VRLLVEEGCEDRILVAHDIHTKTRLMKYGGHGYSHILTNVVPKMLLRGITENVLDKILIENPKQWLTFK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001001484
RefSeq Size 3826
RefSeq ORF 1047
Synonyms HPHRP; RPR-1
Locus ID 9317
UniProt ID Q96BW5
Cytogenetics 10p13
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PTER" proteins (6)
SKU Description Size Price
LC410742 Lyophilized PTER HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424361 Lyophilized PTER HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410742 Transient overexpression lysate of phosphotriesterase related (PTER), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424361 Transient overexpression lysate of phosphotriesterase related (PTER), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP308362 Recombinant protein of human phosphotriesterase related (PTER), transcript variant 1, 20 µg 20 ug
$867.00
TP760854 Purified recombinant protein of Human phosphotriesterase related (PTER), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products