OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ADA2 (NM_017424) Human Mass Spec Standard

Be the first to review this product
SKU
PH308252
CECR1 MS Standard C13 and N15-labeled recombinant protein (NP_059120)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA369947 ADA2 rabbit polyclonal antibody
100 ul
$310.00
LY406155 Transient overexpression lysate of cat eye syndrome chromosome region, candidate 1 (CECR1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "CECR1 or NM_017424"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208252
Predicted MW 58.9 kDa
Protein Sequence
Protein Sequence
>RC208252 protein sequence
Red=Cloning site Green=Tags(s)

MLVDGPSERPALCFLLLAVAMSFFGSALSIDETRAHLLLKEKMMRLGGRLVLNTKEELANERLMTLKIAE
MKEAMRTLIFPPSMHFFQAKHLIERSQVFNILRMMPKGAALHLHDIGIVTMDWLVRNVTYRPHCHICFTP
RGIMQFRFAHPTPRPSEKCSKWILLEDYRKRVQNVTEFDDSLLRNFTLVTQHPEVIYTNQNVVWSKFETI
FFTISGLIHYAPVFRDYVFRSMQEFYEDNVLYMEIRARLLPVYELSGEHHDEEWSVKTYQEVAQKFVETH
PEFIGIKIIYSDHRSKDVAVIAESIRMAMGLRIKFPTVVAGFDLVGHEDTGHSLHDYKEALMIPAKDGVK
LPYFFHAGETDWQGTSIDRNILDALMLNTTRIGHGFALSKHPALRTYSWKKDIPIEVCPISNQVLKLVSD
LRNHPVATLMATGHPMVISSDDPAMFGAKGLSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEK
NTFMEIWKKRWDKFIADVATK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_059120
RefSeq Size 3947
RefSeq ORF 1533
Synonyms ADA2; ADGF; IDGFL
Locus ID 51816
UniProt ID Q9NZK5
Cytogenetics 22q11.1
Summary This gene encodes a member of a subfamily of the adenosine deaminase protein family. The encoded protein is one of two adenosine deaminases found in humans, which regulate levels of the signaling molecule, adenosine. The encoded protein is secreted from monocytes undergoing differentiation and may regulate cell proliferation and differentiation. This gene may be responsible for some of the phenotypic features associated with cat eye syndrome. Alternative splicing results in multiple transcript variants. provided by RefSeq, Aug 2013
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CECR1" proteins (5)
SKU Description Size Price
LC406155 Lyophilized CECR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413782 Lyophilized CECR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406155 Transient overexpression lysate of cat eye syndrome chromosome region, candidate 1 (CECR1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY413782 Transient overexpression lysate of cat eye syndrome chromosome region, candidate 1 (CECR1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP308252 Recombinant protein of human cat eye syndrome chromosome region, candidate 1 (CECR1), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products