OLAH (NM_001039702) Human Mass Spec Standard
CAT#: PH308251
OLAH MS Standard C13 and N15-labeled recombinant protein (NP_001034791)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208251 |
Predicted MW | 29.9 kDa |
Protein Sequence |
>RC208251 protein sequence
Red=Cloning site Green=Tags(s) MERGDQPKRTRNENIFNCLYKNPEATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEP LENDISQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHR IPKDDELSEEQISHYLMEFGGTPKHFAEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGS EDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLDPANEKLIKNYIIKCLEVSSISNF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001034791 |
RefSeq Size | 1675 |
RefSeq ORF | 795 |
Synonyms | AURA1; SAST; TE2; THEDC1 |
Locus ID | 55301 |
UniProt ID | Q9NV23 |
Cytogenetics | 10p13 |
Summary | Contributes to the release of free fatty acids from fatty acid synthase (FASN). Has broad substrate specificity, giving rise to a range of free fatty acids with chain lengths between 10 and 16 carbon atoms (C10 - C16).[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Fatty acid biosynthesis, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400421 | OLAH HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC413121 | OLAH HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400421 | Transient overexpression lysate of oleoyl-ACP hydrolase (OLAH), transcript variant 2 |
USD 436.00 |
|
LY413121 | Transient overexpression lysate of oleoyl-ACP hydrolase (OLAH), transcript variant 1 |
USD 436.00 |
|
TP308251 | Recombinant protein of human oleoyl-ACP hydrolase (OLAH), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review