OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

JPH4 (NM_032452) Human Mass Spec Standard

Be the first to review this product
SKU
PH308221
JPH4 MS Standard C13 and N15-labeled recombinant protein (NP_115828)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306684 Rabbit Polyclonal JPH4 Antibody
100 ug
$640.00
LY410089 Transient overexpression lysate of junctophilin 4 (JPH4), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "JPH4 or NM_032452"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208221
Predicted MW 65.7 kDa
Protein Sequence
Protein Sequence
>RC208221 representing NM_032452
Red=Cloning site Green=Tags(s)

MSPGGKFDFDDGGCYVGGWEAGRAHGYGVCTGPGAQGEYSGCWAHGFESLGVFTGPGGHSYQGHWQQGKR
EGLGVERKSRWTYRGEWLGGLKGRSGVWESVSGLRYAGLWKDGFQDGYGTETYSDGGTYQGQWQAGKRHG
YGVRQSVPYHQAALLRSPRRTSLDSGHSDPPTPPPPLPLPGDEGGSPASGSRGGFVLAGPGDADGASSRK
RTPAAGGFFRRSLLLSGLRAGGRRSSLGSKRGSLRSEVSSEVGSTGPPGSEASGPPAAAPPALIEGSATE
VYAGEWRADRRSGFGVSQRSNGLRYEGEWLGNQRHGYGRTTRPDGSREEGKYKRNRLVHGGRVRSLLPLA
LRRGKVKEKVDRAVEGARRAVSAARQRQEIAAARAADALLKAVAASSVAEKAVEAARMAKLIAQDLQPML
EAPGRRPRQDSEGSDTEPLDEDSPGVYENGLTPSEGSPELPSSPASSRQPWRPPACRSPLPPGGDQGPFS
SPKAWPEEWGGAGAQAEELAGYEAEDEAGMQGPGPRDGSPLLGGCSDSSGSLREEEGEDEEPLPPLRAPA
GTEPEPIAMLVLRGSSSRGHDAGCLTEELGEPAATERPAQPGAANPLVVGAVALLDLSLAFLFSQLLT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115828
RefSeq Size 4396
RefSeq ORF 1884
Synonyms JP4; JPHL1
Locus ID 84502
UniProt ID Q96JJ6
Cytogenetics 14q11.2
Summary This gene encodes a member of the junctophilin family of transmembrane proteins that are involved in the formation of the junctional membrane complexes between the plasma membrane and the endoplasmic/sarcoplasmic reticulum in excitable cells. The encoded protein contains a conserved N-terminal repeat region called the membrane occupation and recognition nexus sequence that is found in other members of the junctophilin family. Alternative splicing results in multiple transcript variants. provided by RefSeq, Mar 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "JPH4" proteins (5)
SKU Description Size Price
LC410089 Lyophilized JPH4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432005 Lyophilized JPH4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410089 Transient overexpression lysate of junctophilin 4 (JPH4), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY432005 Transient overexpression lysate of junctophilin 4 (JPH4), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP308221 Recombinant protein of human junctophilin 4 (JPH4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products