JPH4 (NM_032452) Human Recombinant Protein

SKU
TP308221
Recombinant protein of human junctophilin 4 (JPH4), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208221 representing NM_032452
Red=Cloning site Green=Tags(s)

MSPGGKFDFDDGGCYVGGWEAGRAHGYGVCTGPGAQGEYSGCWAHGFESLGVFTGPGGHSYQGHWQQGKR
EGLGVERKSRWTYRGEWLGGLKGRSGVWESVSGLRYAGLWKDGFQDGYGTETYSDGGTYQGQWQAGKRHG
YGVRQSVPYHQAALLRSPRRTSLDSGHSDPPTPPPPLPLPGDEGGSPASGSRGGFVLAGPGDADGASSRK
RTPAAGGFFRRSLLLSGLRAGGRRSSLGSKRGSLRSEVSSEVGSTGPPGSEASGPPAAAPPALIEGSATE
VYAGEWRADRRSGFGVSQRSNGLRYEGEWLGNQRHGYGRTTRPDGSREEGKYKRNRLVHGGRVRSLLPLA
LRRGKVKEKVDRAVEGARRAVSAARQRQEIAAARAADALLKAVAASSVAEKAVEAARMAKLIAQDLQPML
EAPGRRPRQDSEGSDTEPLDEDSPGVYENGLTPSEGSPELPSSPASSRQPWRPPACRSPLPPGGDQGPFS
SPKAWPEEWGGAGAQAEELAGYEAEDEAGMQGPGPRDGSPLLGGCSDSSGSLREEEGEDEEPLPPLRAPA
GTEPEPIAMLVLRGSSSRGHDAGCLTEELGEPAATERPAQPGAANPLVVGAVALLDLSLAFLFSQLLT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 65.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_115828
Locus ID 84502
UniProt ID Q96JJ6
Cytogenetics 14q11.2
RefSeq Size 4396
RefSeq ORF 1884
Synonyms JP4; JPHL1
Summary This gene encodes a member of the junctophilin family of transmembrane proteins that are involved in the formation of the junctional membrane complexes between the plasma membrane and the endoplasmic/sarcoplasmic reticulum in excitable cells. The encoded protein contains a conserved N-terminal repeat region called the membrane occupation and recognition nexus sequence that is found in other members of the junctophilin family. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2009]
Write Your Own Review
You're reviewing:JPH4 (NM_032452) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308221 JPH4 MS Standard C13 and N15-labeled recombinant protein (NP_115828) 10 ug
$3,255.00
LC410089 JPH4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432005 JPH4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410089 Transient overexpression lysate of junctophilin 4 (JPH4), transcript variant 1 100 ug
$436.00
LY432005 Transient overexpression lysate of junctophilin 4 (JPH4), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.