ETV6 (NM_001987) Human Mass Spec Standard

CAT#: PH308185

ETV6 MS Standard C13 and N15-labeled recombinant protein (NP_001978)

Product Images

Coomassie blue staining of purified ETV6 protein (Cat# TP308185). The protein was produced from HEK293T cells transfected with ETV6 cDNA clone (Cat# RC208185) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208185
• Predicted MW: 53 kDa
• Protein Sequence:
  Sequence Link

  >RC208185 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRLQPIYWSRDDVAQWL
  KWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSI
  HTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLHRSRSPITTNHRPSPDPEQRPLRSPLDNMIR
  RLSPAERAQGPRPHQENNHQESYPLSVSPMENNHCPASSESHPKPSSPRQESTRVIQLMPSPIMHPLILN
  PRHSVDFKQSRLSEDGLHREGKPINLSHREDLAYMNHIMVSVSPPEEHAMPIGRIADCRLLWDYVYQLLS
  DSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFM
  KTPDEIMSGRTDRLEHLESQELDEQIYQEDEC
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001978
• RefSeq Size: 5989
• RefSeq ORF: 1356
• Synonyms: TEL; TEL/ABL; THC5
• Locus ID: 2120
• UniProt ID: P41212, A0A0S2Z3C9
• Cytogenetics: 12p13.2
• Summary: This gene encodes an ETS family transcription factor. The product of this gene contains two functional domains: a N-terminal pointed (PNT) domain that is involved in protein-protein interactions with itself and other proteins, and a C-terminal DNA-binding domain. Gene knockout studies in mice suggest that it is required for hematopoiesis and maintenance of the developing vascular network. This gene is known to be involved in a large number of chromosomal rearrangements associated with leukemia and congenital fibrosarcoma. [provided by RefSeq, Sep 2008]
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Dorso-ventral axis formation