OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DNAJC3 (NM_006260) Human Mass Spec Standard

Be the first to review this product
SKU
PH308126
DNAJC3 MS Standard C13 and N15-labeled recombinant protein (NP_006251)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA322516 Anti-DNAJC3 Rabbit Polyclonal Antibody
100 ul
$305.00
LY416762 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 3 (DNAJC3) (as WB positive control) 100 ug
$436.00

Other products for "DNAJC3 or NM_006260"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208126
Predicted MW 57.6 kDa
Protein Sequence
Protein Sequence
>RC208126 protein sequence
Red=Cloning site Green=Tags(s)

MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDN
YIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENE
EKEAQSQLIKSDEMQRLRSQALNAFGSGDYTAAIAFLDKILEVCVWDAELRELRAECFIKEGEPRKAISD
LKAASKLKNDNTEAFYKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIR
DGRYTDATSKYESVMKTEPSIAEYTVRSKERICHCFSKDEKPVEAIRVCSEVLQMEPDNVNALKDRAEAY
LIEEMYDEAIQDYETAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQ
WHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDGEDPLDAESQQGGGGNPFHRSWNSWQGFNP
FSSGGPFRFKFHFN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006251
RefSeq Size 5598
RefSeq ORF 1512
Synonyms ACPHD; ERdj6; HP58; P58; p58(IPK); P58IPK; PRKRI
Locus ID 5611
UniProt ID Q13217
Cytogenetics 13q32.1
Summary This gene encodes a protein with multiple tetratricopeptide repeat (TPR) motifs as well as the highly conserved J domain found in DNAJ chaperone family members. It is a member of the tetratricopeptide repeat family of proteins and acts as an inhibitor of the interferon-induced, dsRNA-activated protein kinase (PKR). provided by RefSeq, Jul 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DNAJC3" proteins (3)
SKU Description Size Price
LC416762 Lyophilized DNAJC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416762 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 3 (DNAJC3) (as WB positive control) 100 ug
$436.00
TP308126 Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 3 (DNAJC3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products