OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DMRT1 (NM_021951) Human Mass Spec Standard

Be the first to review this product
SKU
PH308108
DMRT1 MS Standard C13 and N15-labeled recombinant protein (NP_068770)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA807746 DMRT1 mouse monoclonal antibody, clone OTI2H1 (formerly 2H1) 100 ul
$447.00
LY411862 Transient overexpression lysate of doublesex and mab-3 related transcription factor 1 (DMRT1) (as WB positive control) 100 ug
$436.00

Other products for "DMRT1 or NM_021951"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208108
Predicted MW 39.5 kDa
Protein Sequence
Protein Sequence
>RC208108 protein sequence
Red=Cloning site Green=Tags(s)

MPNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVGAASGSSAGGSSRGGGSGSGASDLGAGSKKS
PRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQVALRRQQAQEEELGISHPIPLP
SAAELLVKRENNGSNPCLMTECSGTSQPPPASVPTTAASEGRMVIQDIPAVTSRGHVENTPDLVSDSTYY
SSFYQPSLFPYYNNLYNCPQYSMALAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMEN
RHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKA
VLECEPASEPSSFTVTPVIEEDE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_068770
RefSeq Size 2229
RefSeq ORF 1119
Synonyms CT154; DMT1
Locus ID 1761
UniProt ID Q9Y5R6
Cytogenetics 9p24.3
Summary This gene is found in a cluster with two other members of the gene family, having in common a zinc finger-like DNA-binding motif (DM domain). The DM domain is an ancient, conserved component of the vertebrate sex-determining pathway that is also a key regulator of male development in flies and nematodes. This gene exhibits a gonad-specific and sexually dimorphic expression pattern. Defective testicular development and XY feminization occur when this gene is hemizygous. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DMRT1" proteins (3)
SKU Description Size Price
LC411862 Lyophilized DMRT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411862 Transient overexpression lysate of doublesex and mab-3 related transcription factor 1 (DMRT1) (as WB positive control) 100 ug
$436.00
TP308108 Recombinant protein of human doublesex and mab-3 related transcription factor 1 (DMRT1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products