OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FOXP4 (NM_138457) Human Mass Spec Standard

Be the first to review this product
SKU
PH308077
FOXP4 MS Standard C13 and N15-labeled recombinant protein (NP_612466)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY422862 Transient overexpression lysate of forkhead box P4 (FOXP4), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "FOXP4 or NM_138457"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208077
Predicted MW 72.2 kDa
Protein Sequence
Protein Sequence
>RC208077 protein sequence
Red=Cloning site Green=Tags(s)

MMVESASETIRSAPSGQNGVGSLSGQADGSSGGATGTTASGTGREVTTGADSNGEMSPAELLHFQQQQAL
QVARQFLLQQASGLSSPGNNDSKQSASAVQVPVSVAMMSPQMLTPQQMQQILSPPQLQALLQQQQALMLQ
QLQEYYKKQQEQLHLQLLTQQQAGKPQPKEALGNKQLAFQQQLLQMQQLQQQHLLNLQRQGLVSLQPNQA
SGPLQTLPQAVCPTDLPQLWKGEGAPGQPAEDSVKQEGLDLTGTAATATSFAAPPKVSPPLSHHTLPNGQ
PTVLTSRRDSSSHEETPGSHPLYGHGECKWPGCETLCEDLGQFIKHLNTEHALDDRSTAQCRVQMQVVQQ
LEIQLAKESERLQAMMAHLHMRPSEPKPFSQPVTVSAADSFPDGLVHPPTSAAAPVTPLRPPGLGSASLH
GGGPARRRSSDKFCSPISSELAQNHEFYKNADVRPPFTYASLIRQAILETPDRQLTLNEIYNWFTRMFAY
FRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEREYQKRRPPKMTGSPTLVKNMISGLSYGALNAS
YQAALAESSFPLLNSPGMLNPGSASSLLPLSHDDVGAPVEPLPSNGSSSPPRLSPPQYSHQVQVKEEPAE
AEEDRQPGPPLGAPNPSASGPPEDRDLEEELPGEELS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612466
RefSeq Size 5926
RefSeq ORF 2001
Synonyms hFKHLA
Locus ID 116113
UniProt ID Q8IVH2
Cytogenetics 6p21.1
Summary This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Many members of the forkhead box gene family, including members of subfamily P, have roles in mammalian oncogenesis. This gene may play a role in the development of tumors of the kidney and larynx. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. provided by RefSeq, Jul 2008
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FOXP4" proteins (7)
SKU Description Size Price
PH308611 FOXP4 MS Standard C13 and N15-labeled recombinant protein (NP_001012426) 10 ug
$3,360.00
LC408607 Lyophilized FOXP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422862 Lyophilized FOXP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408607 Transient overexpression lysate of forkhead box P4 (FOXP4), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422862 Transient overexpression lysate of forkhead box P4 (FOXP4), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP308077 Recombinant protein of human forkhead box P4 (FOXP4), transcript variant 2, 20 µg 20 ug
$867.00
TP308611 Recombinant protein of human forkhead box P4 (FOXP4), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products