OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RALA (NM_005402) Human Mass Spec Standard

Be the first to review this product
SKU
PH308076
RALA MS Standard C13 and N15-labeled recombinant protein (NP_005393)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY417324 Transient overexpression lysate of v-ral simian leukemia viral oncogene homolog A (ras related) (RALA) (as WB positive control) 100 ug
$436.00

Other products for "RALA or NM_005402"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208076
Predicted MW 23.6 kDa
Protein Sequence
Protein Sequence
>RC208076 protein sequence
Red=Cloning site Green=Tags(s)

MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA
GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVE
EAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005393
RefSeq Size 2828
RefSeq ORF 618
Synonyms HINCONS; RAL
Locus ID 5898
UniProt ID P11233
Cytogenetics 7p14.1
Summary The product of this gene belongs to the small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. This gene encodes a low molecular mass ras-like GTP-binding protein that shares about 50% similarity with other ras proteins. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Pancreatic cancer, Pathways in cancer
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RALA" proteins (3)
SKU Description Size Price
LC417324 Lyophilized RALA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417324 Transient overexpression lysate of v-ral simian leukemia viral oncogene homolog A (ras related) (RALA) (as WB positive control) 100 ug
$436.00
TP308076 Recombinant protein of human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products