REM (REM1) (NM_014012) Human Mass Spec Standard

CAT#: PH308010

REM1 MS Standard C13 and N15-labeled recombinant protein (NP_054731)

Product Images

Coomassie blue staining of purified REM1 protein (Cat# TP308010). The protein was produced from HEK293T cells transfected with REM1 cDNA clone (Cat# RC208010) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208010
• Predicted MW: 32.9 kDa
• Protein Sequence:
  Sequence Link

  >RC208010 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTLNTEQEAKTPLHRRASTPLPLSPRGHQPGRLSTVPSTQSQHPRLGQSASLNPPTQKPSPAPDDWSSES
  SDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERTLTVDGEDTTLVVVDTWEAEK
  LDKSWSQESCLQGGSAYVIVYSIADRGSFESASELRIQLRRTHQADHVPIILVGNKADLARCREVSVEEG
  RACAVVFDCKFIETSATLQHNVAELFEGVVRQLRLRRRDSAAKEPPAPRRPASLAQRARRFLARLTARSA
  RRRALKARSKSCHNLAVL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_054731
• RefSeq Size: 1689
• RefSeq ORF: 894
• Synonyms: GD:REM; GES
• Locus ID: 28954
• UniProt ID: O75628
• Cytogenetics: 20q11.21
• Summary: The protein encoded by this gene is a GTPase and member of the RAS-like GTP-binding protein family. The encoded protein is expressed in endothelial cells, where it promotes reorganization of the actin cytoskeleton and morphological changes in the cells. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome