OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

APLF (NM_173545) Human Mass Spec Standard

Be the first to review this product
SKU
PH307936
APLF MS Standard C13 and N15-labeled recombinant protein (NP_775816)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349484 Rabbit Polyclonal Anti-APLF Antibody
100 ul
$205.00
LY406456 Transient overexpression lysate of aprataxin and PNKP like factor (APLF) (as WB positive control) 100 ug
$436.00

Other products for "APLF or NM_173545"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207936
Predicted MW 57 kDa
Protein Sequence
Protein Sequence
>RC207936 protein sequence
Red=Cloning site Green=Tags(s)

MSGGFELQPRDGGPRVALAPGETVIGRGPLLGITDKRVSRRHAILEVAGGQLRIKPIHTNPCFYQSSEKS
QLLPLKPNLWCYLNPGDSFSLLVDKYIFRILSIPSEVEMQCTLRNSQVLDEDNILNETPKSPVINLPHET
TGASQLEGSTEIAKTQMTPTNSVSFLGENRDCNKQQPILAERKRILPTWMLAEHLSDQNLSVPAISGGNV
IQGSGKEEICKDKSQLNTTQQGRRQLISSGSSENTSAEQDTGEECKNTDQEESTISSKEMPQSFSAITLS
NTEMNNIKTNAQRNKLPIEELGKVSKHKIATKRTPHKEDEAMSCSENCSSAQGDSLQDESQGSHSESSSN
PSNPETLHAKATDSVLQGSEGNKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGGVQIVGQDETDDRPE
CPYGPSCYRKNPQHKIEYRHNTLPVRNVLDEDNDNVGQPNEYDLNDSFLDDEEEDYEPTDEDSDWEPGKE
DEEKEDVEELLKEAKRFMKRK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_775816
RefSeq Size 3869
RefSeq ORF 1533
Synonyms APFL; C2orf13; PALF; Xip1; ZCCHH1
Locus ID 200558
UniProt ID Q8IW19
Cytogenetics 2p13.3
Summary C2ORF13 is a component of the cellular response to chromosomal DNA single- and double-strand breaks (Iles et al., 2007 PubMed 17353262).supplied by OMIM, Mar 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "APLF" proteins (4)
SKU Description Size Price
LC406456 Lyophilized APLF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406456 Transient overexpression lysate of aprataxin and PNKP like factor (APLF) (as WB positive control) 100 ug
$436.00
TP307936 Recombinant protein of human aprataxin and PNKP like factor (APLF), 20 µg 20 ug
$737.00
TP710318 Purified recombinant protein of Human aprataxin and PNKP like factor (APLF), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products