FRMD8 (NM_031904) Human Mass Spec Standard

CAT#: PH307879

FRMD8 MS Standard C13 and N15-labeled recombinant protein (NP_114110)

Product Images

Coomassie blue staining of purified FRMD8 protein (Cat# TP307879). The protein was produced from HEK293T cells transfected with FRMD8 cDNA clone (Cat# RC207879) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207879
• Predicted MW: 51.2 kDa
• Protein Sequence:
  Sequence Link

  >RC207879 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDGTEGSAGQPGPAERSHRSSVSSVGARAADVLVYLADDTVVPLAVENLPSLSAHELHRAVREVLQLPDI
  ALDVFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTSAPDDDVAMDEPFLQFRRNVFFPKRRELQIH
  DEEVLRLLYEEAKGNVLAARYPCDVEDCEALGALVCRVQLGPYQPGRPAACDLREKLDSFLPAHLCKRGQ
  SLFAALRGRGARAGPGEQGLLNAYRQVQEVSSDGGCEAALGTHYRAYLLKCHELPFYGCAFFHGEVDKPA
  QGFLHRGGRKPVSVAISLEGVHVIDSREKHVLLGLRFQELSWDHTSPEEEEPILWLEFDGDSEGTPVNKL
  LKIYSKQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTI
  DYVEDGKGIRRVKPKRTTSFFSRQLSLGQGSYTVVQPGDSLEQG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_114110
• RefSeq Size: 3774
• RefSeq ORF: 1392
• Synonyms: FKSG44; iTAP
• Locus ID: 83786
• UniProt ID: Q9BZ67, A8K6L3
• Cytogenetics: 11q13.1
• Summary: Promotes the cell surface stability of iRhom1/RHBDF1 and iRhom2/RHBDF2 and prevents their degradation via the endolysosomal pathway. By acting on iRhoms, involved in ADAM17-mediated shedding of TNF, amphiregulin/AREG, HBEGF and TGFA from the cell surface (PubMed:29897333, PubMed:29897336). Negatively regulates Wnt signaling, possibly by antagonizing the recruitment of AXIN1 to LRP6 (PubMed:19572019).[UniProtKB/Swiss-Prot Function]