OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HBM (NM_001003938) Human Mass Spec Standard

Be the first to review this product
SKU
PH307833
HBM MS Standard C13 and N15-labeled recombinant protein (NP_001003938)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY424039 Transient overexpression lysate of hemoglobin, mu (HBM) (as WB positive control) 100 ug
$436.00

Other products for "HBM or NM_001003938"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207833
Predicted MW 15.6 kDa
Protein Sequence
Protein Sequence
>RC207833 protein sequence
Red=Cloning site Green=Tags(s)

MLSAQERAQIAQVWDLIAGHEAQFGAELLLRLFTVYPSTKVYFPHLSACQDATQLLSHGQRMLAAVGAAV
QHVDNLRAALSPLADLHALVLRVDPANFPLLIQCFHVVLASHLQDEFTVQMQAAWDKFLTGVAVVLTEKY
R

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001003938
RefSeq Size 524
RefSeq ORF 423
Synonyms HBAP2; HBK
Locus ID 3042
UniProt ID Q6B0K9
Cytogenetics 16p13.3
Summary The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'. This gene has an ORF encoding a 141 aa polypeptide which is similar to the delta globins found in reptiles and birds. This locus was originally described as a pseudogene; however, it is currently thought to be a protein-coding gene. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HBM" proteins (3)
SKU Description Size Price
LC424039 Lyophilized HBM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY424039 Transient overexpression lysate of hemoglobin, mu (HBM) (as WB positive control) 100 ug
$436.00
TP307833 Recombinant protein of human hemoglobin, mu (HBM), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products