HBM (NM_001003938) Human Tagged ORF Clone

SKU
RC207833
HBM (Myc-DDK-tagged)-Human hemoglobin, mu (HBM)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HBM
Synonyms HBAP2; HBK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207833 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCAGCGCCCAGGAGCGCGCCCAAATCGCGCAGGTCTGGGACCTGATTGCGGGCCACGAGGCGCAAT
TCGGGGCGGAGCTGCTGCTCAGGCTCTTCACGGTGTACCCCAGCACCAAGGTCTACTTCCCGCACCTGAG
CGCCTGCCAGGACGCGACGCAGCTGCTGAGCCACGGGCAGCGCATGCTGGCGGCTGTGGGCGCGGCGGTG
CAGCACGTGGACAACCTGCGCGCCGCGCTGAGCCCGCTGGCGGACCTGCACGCGCTCGTGCTGCGCGTGG
ACCCAGCCAACTTTCCGCTGCTAATCCAGTGTTTCCACGTCGTGCTGGCCTCCCACCTGCAGGACGAGTT
CACCGTGCAAATGCAAGCGGCGTGGGACAAGTTCCTGACTGGTGTGGCCGTGGTGCTGACCGAAAAATAC
CGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207833 protein sequence
Red=Cloning site Green=Tags(s)

MLSAQERAQIAQVWDLIAGHEAQFGAELLLRLFTVYPSTKVYFPHLSACQDATQLLSHGQRMLAAVGAAV
QHVDNLRAALSPLADLHALVLRVDPANFPLLIQCFHVVLASHLQDEFTVQMQAAWDKFLTGVAVVLTEKY
R

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001003938
ORF Size 423 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001003938.4
RefSeq Size 524 bp
RefSeq ORF 426 bp
Locus ID 3042
UniProt ID Q6B0K9
Cytogenetics 16p13.3
MW 15.6 kDa
Summary The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'. This gene has an ORF encoding a 141 aa polypeptide which is similar to the delta globins found in reptiles and birds. This locus was originally described as a pseudogene; however, it is currently thought to be a protein-coding gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:HBM (NM_001003938) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207833L3 Lenti ORF clone of Human hemoglobin, mu (HBM), Myc-DDK-tagged 10 ug
$450.00
RC207833L4 Lenti ORF clone of Human hemoglobin, mu (HBM), mGFP tagged 10 ug
$450.00
RG207833 HBM (tGFP-tagged) - Human hemoglobin, mu (HBM) 10 ug
$489.00
SC321972 HBM (untagged)-Human hemoglobin, mu (HBM) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.