OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

cIAP2 (BIRC3) (NM_001165) Human Mass Spec Standard

Be the first to review this product
SKU
PH307764
BIRC3 MS Standard C13 and N15-labeled recombinant protein (NP_001156)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA800063 BIRC3 (cIAP2) mouse monoclonal antibody, clone OTI3G4 (formerly 3G4) 100 ul
$447.00
LY420093 Transient overexpression lysate of baculoviral IAP repeat-containing 3 (BIRC3), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "cIAP2 or NM_001165"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207764
Predicted MW 68.4 kDa
Protein Sequence
Protein Sequence
>RC207764 protein sequence
Red=Cloning site Green=Tags(s)

MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCG
LMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNSTHSLLPGTENSGYFRGSYSN
SPSNPVNSRANQDFSALMRSSYHCAMNNENARLLTFQTWPLTFLSPTDLAKAGFYYIGPGDRVACFACGG
KLSNWEPKDNAMSEHLRHFPKCPFIENQLQDTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAG
FYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSD
SPGDENAESSIIHFEPGEDHSEDAIMMNTPVINAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDL
LNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTAGIINEQEHDVIKQKTQTSL
QARELIDTILVKGNIAATVFRNSLQEAEAVLYEHLFVQQDIKYIPTEDVSDLPVEEQLRRLQEERTCKVC
MDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFLS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001156
RefSeq Size 6932
RefSeq ORF 1812
Synonyms AIP1; API2; c-IAP2; CIAP2; HAIP1; HIAP1; IAP-1; MALT2; MIHC; RNF49
Locus ID 330
UniProt ID Q13489
Cytogenetics 11q22.2
Summary This gene encodes a member of the IAP family of proteins that inhibit apoptosis by binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2, probably by interfering with activation of ICE-like proteases. The encoded protein inhibits apoptosis induced by serum deprivation but does not affect apoptosis resulting from exposure to menadione, a potent inducer of free radicals. It contains 3 baculovirus IAP repeats and a ring finger domain. Transcript variants encoding the same isoform have been identified. provided by RefSeq, Aug 2011
Protein Families Druggable Genome
Protein Pathways Apoptosis, Focal adhesion, NOD-like receptor signaling pathway, Pathways in cancer, Small cell lung cancer, Ubiquitin mediated proteolysis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "cIAP2" proteins (7)
SKU Description Size Price
PH311599 BIRC3 MS Standard C13 and N15-labeled recombinant protein (NP_892007) 10 ug
$3,360.00
LC405280 Lyophilized BIRC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420093 Lyophilized BIRC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405280 Transient overexpression lysate of baculoviral IAP repeat-containing 3 (BIRC3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY420093 Transient overexpression lysate of baculoviral IAP repeat-containing 3 (BIRC3), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP307764 Recombinant protein of human baculoviral IAP repeat-containing 3 (BIRC3), transcript variant 1, 20 µg 20 ug
$737.00
TP311599 Recombinant protein of human baculoviral IAP repeat-containing 3 (BIRC3), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products