OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AHSP (NM_016633) Human Mass Spec Standard

Be the first to review this product
SKU
PH307743
AHSP MS Standard C13 and N15-labeled recombinant protein (NP_057717)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA319485 Anti-AHSP (RABBIT) Antibody, 100 uL, Serum
100 ul
$870.00
LY413883 Transient overexpression lysate of alpha hemoglobin stabilizing protein (AHSP) (as WB positive control) 100 ug
$436.00

Other products for "AHSP or NM_016633"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207743
Predicted MW 11.8 kDa
Protein Sequence
Protein Sequence
>RC207743 protein sequence
Red=Cloning site Green=Tags(s)

MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQEL
RQELNTLANPFLAKYRDFLKSHELPSHPPPSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057717
RefSeq Size 518
RefSeq ORF 306
Synonyms EDRF; ERAF
Locus ID 51327
UniProt ID Q9NZD4
Cytogenetics 16p11.2
Summary This gene encodes a molecular chaperone which binds specifically to free alpha-globin and is involved in hemoglobin assembly. The encoded protein binds to monomeric alpha-globin until it has been transferred to beta-globin to form a heterodimer, which in turn binds to another heterodimer to form the stable tetrameric hemoglobin. Alternative splicing results in multiple transcript variants. provided by RefSeq, Dec 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "AHSP" proteins (3)
SKU Description Size Price
LC413883 Lyophilized AHSP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413883 Transient overexpression lysate of alpha hemoglobin stabilizing protein (AHSP) (as WB positive control) 100 ug
$436.00
TP307743 Recombinant protein of human erythroid associated factor (ERAF), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products