OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MTMR14 (NM_001077525) Human Mass Spec Standard

Be the first to review this product
SKU
PH307732
MTMR14 MS Standard C13 and N15-labeled recombinant protein (NP_001070993)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY411652 Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "MTMR14 or NM_001077525"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207732
Predicted MW 72.2 kDa
Protein Sequence
Protein Sequence
>RC207732 protein sequence
Red=Cloning site Green=Tags(s)

MAGARAAAAAASAGSSASSGNQPPQELGLGELLEEFSRTQYRAKDGSGTGGSKVERIEKRCLELFGRDYC
FSVIPNTNGDICGHYPRHIVFLEYESSEKEKDTFESTVQVSKLQDLIHRSKMARCRGRFVCPVILFKGKH
ICRSATLAGWGELYGRSGYNYFFSGGADDAWADVEDVTEEDCALRSGDTHLFDKVRGYDIKLLRYLSVKY
ICDLMVENKKVKFGMNVTSSEKVDKAQRYADFTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAP
LSIPDFLTHSLNIDWSQYQCWDLVQQTQNYLKLLLSLVNSDDDSGLLVHCISGWDRTPLFISLLRLSLWA
DGLIHTSLKPTEILYLTVAYDWFLFGHMLVDRLSKGEEIFFFCFNFLKHITSEEFSALKTQRRKSLPARD
GGFTLEDICMLRRKDRGSTTSLGSDFSLVMESSPGATGSFTYEAVELVPAGAPTQAAWRKSHSSSPQSVL
WNRPQPSEDRLPSQQGLAEARSSSSSSSNHSDNFFRMGSSPLEVPKPRSVDHPLPGSSLSTDYGSWQMVT
GCGSIQERAVLHTDSSLPFSFPDELPNSCLLAALSDRETRLQEVRSAFLAAYSSTVGLRAVAPSPSGAIG
GLLEQFARGVGLRSISSNAL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001070993
RefSeq Size 2536
RefSeq ORF 1950
Synonyms C3orf29
Locus ID 64419
UniProt ID Q8NCE2
Cytogenetics 3p25.3
Summary This gene encodes a myotubularin-related protein. The encoded protein is a phosphoinositide phosphatase that specifically dephosphorylates phosphatidylinositol 3,5-biphosphate and phosphatidylinositol 3-phosphate. Mutations in this gene are correlated with autosomal dominant centronuclear myopathy. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 18.provided by RefSeq, Apr 2010
Protein Families Druggable Genome, Phosphatase, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MTMR14" proteins (11)
SKU Description Size Price
PH300809 MTMR14 MS Standard C13 and N15-labeled recombinant protein (NP_071930) 10 ug
$3,360.00
PH308660 MTMR14 MS Standard C13 and N15-labeled recombinant protein (NP_001070994) 10 ug
$3,360.00
LC411652 Lyophilized MTMR14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421457 Lyophilized MTMR14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421458 Lyophilized MTMR14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411652 Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY421457 Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY421458 Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP300809 Recombinant protein of human myotubularin related protein 14 (MTMR14), transcript variant 3, 20 µg 20 ug
$737.00
TP307732 Recombinant protein of human myotubularin related protein 14 (MTMR14), transcript variant 2, 20 µg 20 ug
$737.00
TP308660 Recombinant protein of human myotubularin related protein 14 (MTMR14), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products