MTMR14 (NM_022485) Human Mass Spec Standard

SKU
PH300809
MTMR14 MS Standard C13 and N15-labeled recombinant protein (NP_071930)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200809]
Predicted MW 60 kDa
Protein Sequence
Protein Sequence
>RC200809 protein sequence
Red=Cloning site Green=Tags(s)

MAGARAAAAAASAGSSASSGNQPPQELGLGELLEEFSRTQYRAKDGSGTGGSKVERIEKRCLELFGRDYC
FSVIPNTNGDICGHYPRHIVFLEYESSEKEKDTFESTVQVSKLQDLIHRSKMARCRGRFVCPVILFKGKH
ICRSATLAGWGELYGRSGYNYFFSGGADDAWADVEDVTEEDCALRSGDTHLFDKVRGYDIKLLRYLSVKY
ICDLMVENKKVKFGMNVTSSEKVDKAQRYADFTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAP
LSIPDFLTHSLNIDWSQYQCWDLVQQTQNYLKLLLSLVNSDDDSGLLVHCISGWDRTPLFISLLRLSLWA
DGLIHTSLKPTEILYLTVAYDWFLFGHMLVDRLSKGEEIFFFCFNFLKHITSEEFSALKTQRRKSLPARD
GGFTLEDICMLRRKDRGSTTSLGSDFSLVMESSPGATGSFTYEAVELVPAGAPTQAAWLAALSDRETRLQ
EVRSAFLAAYSSTVGLRAVAPSPSGAIGGLLEQFARGVGLRSISSNAL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071930
RefSeq Size 2200
RefSeq ORF 1614
Synonyms C3orf29
Locus ID 64419
UniProt ID Q8NCE2
Cytogenetics 3p25.3
Summary This gene encodes a myotubularin-related protein. The encoded protein is a phosphoinositide phosphatase that specifically dephosphorylates phosphatidylinositol 3,5-biphosphate and phosphatidylinositol 3-phosphate. Mutations in this gene are correlated with autosomal dominant centronuclear myopathy. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 18.[provided by RefSeq, Apr 2010]
Protein Families Druggable Genome, Phosphatase, Secreted Protein
Write Your Own Review
You're reviewing:MTMR14 (NM_022485) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH307732 MTMR14 MS Standard C13 and N15-labeled recombinant protein (NP_001070993) 10 ug
$3,255.00
PH308660 MTMR14 MS Standard C13 and N15-labeled recombinant protein (NP_001070994) 10 ug
$3,255.00
LC411652 MTMR14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421457 MTMR14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421458 MTMR14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411652 Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 3 100 ug
$436.00
LY421457 Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 2 100 ug
$436.00
LY421458 Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 1 100 ug
$436.00
TP300809 Recombinant protein of human myotubularin related protein 14 (MTMR14), transcript variant 3, 20 µg 20 ug
$737.00
TP307732 Recombinant protein of human myotubularin related protein 14 (MTMR14), transcript variant 2, 20 µg 20 ug
$737.00
TP308660 Recombinant protein of human myotubularin related protein 14 (MTMR14), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.