OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DNAJC8 (NM_014280) Human Mass Spec Standard

Be the first to review this product
SKU
PH307697
DNAJC8 MS Standard C13 and N15-labeled recombinant protein (NP_055095)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA368187 DNAJC8 rabbit polyclonal antibody
100 ul
$310.00
LY415384 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 8 (DNAJC8) (as WB positive control) 100 ug
$436.00

Other products for "DNAJC8 or NM_014280"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207697
Predicted MW 29.7 kDa
Protein Sequence
Protein Sequence
>RC207697 representing NM_014280
Red=Cloning site Green=Tags(s)

MAASGESGTSGGGGSTEEAFMTFYSEVKQIEKRDSVLTSKNQIERLTRPGSSYFNLNPFEVLQIDPEVTD
EEIKKRFRQLSILVHPDKNQDDADRAQKAFEAVDKAYKLLLDQEQKKRALDVIQAGKEYVEHTVKERKKQ
LKKEGKPTIVEEDDPELFKQAVYKQTMKLFAELEIKRKEREAKEMHERKRQREEEIEAQEKAKREREWQK
NFEESRDGRVDSWRNFQANTKGKKEKKNRTFLRPPKVKMEQRE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055095
RefSeq Size 1765
RefSeq ORF 759
Synonyms HSPC331; SPF31
Locus ID 22826
UniProt ID O75937
Cytogenetics 1p35.3
Summary Suppresses polyglutamine (polyQ) aggregation of ATXN3 in neuronal cells (PubMed:27133716).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DNAJC8" proteins (3)
SKU Description Size Price
LC415384 Lyophilized DNAJC8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415384 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 8 (DNAJC8) (as WB positive control) 100 ug
$436.00
TP307697 Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 8 (DNAJC8), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products