OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TSTD2 (NM_139246) Human Mass Spec Standard

Be the first to review this product
SKU
PH307674
TSTD2 MS Standard C13 and N15-labeled recombinant protein (NP_640339)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA355432 TSTD2 Antibody - middle region
100 ul
$575.00
LY408321 Transient overexpression lysate of thiosulfate sulfurtransferase (rhodanese)-like domain containing 2 (TSTD2) (as WB positive control) 100 ug
$436.00

Other products for "TSTD2 or NM_139246"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207674
Predicted MW 55.2 kDa
Protein Sequence
Protein Sequence
>RC207674 protein sequence
Red=Cloning site Green=Tags(s)

MSLINPSSSLKAELDGSTKKKYSFAKKKAFALFVKTKEVPTKRSFECKEKLWKCCQQLFTDQTSIHRHVA
TQHADEIYHQTASILKQLAVTLSTSKSLSSADEKNPLKECLPHSHDVSAWLPDISCFNPDELISGQGSEE
GEVLLYYCYHDLEDPQWICAWQTALCQHLHLTGKIRIAAEGINGTVGGSKLATRLYVEVMLSFPLFKDDL
CKDDFKTSKGGAHCFPELRVGVFEEIVPMGISPKKISYKKPGIHLSPGEFHKEVEKFLSQANQEQSDTIL
LDCRNFYESKIGRFQGCLAPDIRKFSYFPSYVDKNLELFREKRVLMYCTGGIRCERGSAYLKAKGVCKEV
FQLKGGIHKYLEEFPDGFYKGKLFVFDERYALSYNSDVVSECSYCGARWDQYKLCSTPQCRQLVLTCPAC
QGQGFTACCVTCQDKGSRKVSGPMQDSFKEECECTARRPRIPRELLQHVRQPVSPEPGPDADEDGPVLM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_640339
RefSeq Size 4445
RefSeq ORF 1467
Synonyms C9orf97
Locus ID 158427
UniProt ID Q5T7W7
Cytogenetics 9q22.33
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TSTD2" proteins (3)
SKU Description Size Price
LC408321 Lyophilized TSTD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408321 Transient overexpression lysate of thiosulfate sulfurtransferase (rhodanese)-like domain containing 2 (TSTD2) (as WB positive control) 100 ug
$436.00
TP307674 Recombinant protein of human chromosome 9 open reading frame 97 (C9orf97), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products