OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VSTM2L (NM_080607) Human Mass Spec Standard

Be the first to review this product
SKU
PH307656
VSTM2L MS Standard C13 and N15-labeled recombinant protein (NP_542174)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY409151 Transient overexpression lysate of V-set and transmembrane domain containing 2 like (VSTM2L) (as WB positive control) 100 ug
$436.00

Other products for "VSTM2L or NM_080607"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207656
Predicted MW 22.3 kDa
Protein Sequence
Protein Sequence
>RC207656 protein sequence
Red=Cloning site Green=Tags(s)

MGAPLAVALGALHYLALFLQLGGATRPAGHAPWDNHVSGHALFT ETPHDMTARTGEDVEMACSFRGSGS
PSYSLEIQWWYVRSHRDWTDKQAWASNQLKASQ QEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEG
TYECRVIDFSDGKARHHKVKAY LRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_542174
RefSeq Size 2018
RefSeq ORF 612
Synonyms C20orf102; dJ1118M15.2
Locus ID 128434
UniProt ID Q96N03
Cytogenetics 20q11.23
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VSTM2L" proteins (3)
SKU Description Size Price
LC409151 Lyophilized VSTM2L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409151 Transient overexpression lysate of V-set and transmembrane domain containing 2 like (VSTM2L) (as WB positive control) 100 ug
$436.00
TP307656 Recombinant protein of human V-set and transmembrane domain containing 2 like (VSTM2L), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products