OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SEPTIN12 (NM_144605) Human Mass Spec Standard

Be the first to review this product
SKU
PH307655
SEPT12 MS Standard C13 and N15-labeled recombinant protein (NP_653206)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA340338 Rabbit Polyclonal Anti-SEPT12 Antibody
100 ul
$585.00
LY408232 Transient overexpression lysate of septin 12 (SEPT12), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "SEPTIN12 or NM_144605"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207655
Predicted MW 40.7 kDa
Protein Sequence
Protein Sequence
>RC207655 protein sequence
Red=Cloning site Green=Tags(s)

MDPLRRSPSPCLSSQPSSPSTPPCEMLGPVGIEAVLDQLKIKAMKMGFEFNIMVVGQSGLGKSTMVNTLF
KSKVWKSNPPGLGVPTPQTLQLHSLTHVIEEKGVKLKLTVTDTPGFGDQINNDNCWDPILGYINEQYEQY
LQEEILITRQRHIPDTRVHCCVYFVPPTGHCLRPLDIEFLQRLCRTVNVVPVIARADSLTMEEREAFRRR
IQQNLRTHCIDVYPQMCFDEDINDKILNSKLRDRIPFAVVGADQEHLVNGRCVLGRKTKWGIIEVENMAH
CEFPLLRDLLIRSHLQDLKDITHNIHYENYRVIRLNESHLLPRGPGWVNLAPASPGQLTTPRTFKVCRGA
HDDSDDEF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_653206
RefSeq Size 1524
RefSeq ORF 1074
Synonyms SEPT12; SPGF10
Locus ID 124404
UniProt ID Q8IYM1
Cytogenetics 16p13.3
Summary This gene encodes a guanine-nucleotide binding protein and member of the septin family of cytoskeletal GTPases. Septins play important roles in cytokinesis, exocytosis, embryonic development, and membrane dynamics. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Oct 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SEPTIN12" proteins (5)
SKU Description Size Price
LC408232 Lyophilized 42259 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431273 Lyophilized 42259 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408232 Transient overexpression lysate of septin 12 (SEPT12), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY431273 Transient overexpression lysate of septin 12 (SEPT12), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP307655 Recombinant protein of human septin 12 (SEPT12), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products