OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRELP (NM_201348) Human Mass Spec Standard

Be the first to review this product
SKU
PH307609
PRELP MS Standard C13 and N15-labeled recombinant protein (NP_958505)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA324857 PRELP Antibody (C-term)
400 ul
$645.00
LY400959 Transient overexpression lysate of proline/arginine-rich end leucine-rich repeat protein (PRELP), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "PRELP or NM_201348"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207609
Predicted MW 43.8 kDa
Protein Sequence
Protein Sequence
>RC207609 protein sequence
Red=Cloning site Green=Tags(s)

MRSPLCWLLPLLILASVAQGQPTRRPRPGTGPGRRPRPRPRPTPSFPQPDEPAEPTDLPPPLPPGPPSIF
PDCPRECYCPPDFPSALYCDSRNLRKVPVIPPRIHYLYLQNNFITELPVESFQNATGLRWINLDNNRIRK
IDQRVLEKLPGLVFLYMEKNQLEEVPSALPRNLEQLRLSQNHISRIPPGVFSKLENLLLLDLQHNRLSDG
VFKPDTFHGLKNLMQLNLAHNILRKMPPRVPTAIHQLYLDSNKIETIPNGYFKSFPNLAFIRLNYNKLTD
RGLPKNSFNISNLLVLHLSHNRISSVPAINNRLEHLYLNNNSIEKINGTQICPNDLVAFHDFSSDLENVP
HLRYLRLDGNYLKPPIPLDLMMCFRLLQSVVI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_958505
RefSeq Size 5823
RefSeq ORF 1146
Synonyms MST161; MSTP161; SLRR2A
Locus ID 5549
UniProt ID P51888
Cytogenetics 1q32.1
Summary The protein encoded by this gene is a leucine-rich repeat protein present in connective tissue extracellular matrix. This protein functions as a molecule anchoring basement membranes to the underlying connective tissue. This protein has been shown to bind type I collagen to basement membranes and type II collagen to cartilage. It also binds the basement membrane heparan sulfate proteoglycan perlecan. This protein is suggested to be involved in the pathogenesis of Hutchinson-Gilford progeria (HGP), which is reported to lack the binding of collagen in basement membranes and cartilage. Alternatively spliced transcript variants encoding the same protein have been observed. provided by RefSeq, Jul 2008
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PRELP" proteins (5)
SKU Description Size Price
LC400959 Lyophilized PRELP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404518 Lyophilized PRELP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400959 Transient overexpression lysate of proline/arginine-rich end leucine-rich repeat protein (PRELP), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY404518 Transient overexpression lysate of proline/arginine-rich end leucine-rich repeat protein (PRELP), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP307609 Purified recombinant protein of Homo sapiens proline/arginine-rich end leucine-rich repeat protein (PRELP), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products