OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RNF41 (NM_194358) Human Mass Spec Standard

Be the first to review this product
SKU
PH307568
RNF41 MS Standard C13 and N15-labeled recombinant protein (NP_919339)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811158 RNF41 mouse monoclonal antibody,clone OTI2C1 100 ul
$447.00
LY405109 Transient overexpression lysate of ring finger protein 41 (RNF41), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "RNF41 or NM_194358"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207568
Predicted MW 35.9 kDa
Protein Sequence
Protein Sequence
>RC207568 protein sequence
Red=Cloning site Green=Tags(s)

MGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVVTVAHLRPVPR
IMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGCGLEMPKDELPNHNCIKHLRS
VVQQQQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQNLEETIEYNEILEWVNSLQPAR
VTRWGGMISTPDAVLQAVIKRSLVESGCPASIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRI
PGKQAVVVMACENQHMGDDMVQEPGLVMIFAHGVEEI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_919339
RefSeq Size 5420
RefSeq ORF 951
Synonyms FLRF; NRDP1; SBBI03
Locus ID 10193
UniProt ID Q9H4P4
Cytogenetics 12q13.3
Summary This gene encodes an E3 ubiquitin ligase. The encoded protein plays a role in type 1 cytokine receptor signaling by controlling the balance between JAK2-associated cytokine receptor degradation and ectodomain shedding. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jun 2011
Protein Pathways Endocytosis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RNF41" proteins (8)
SKU Description Size Price
LC405109 Lyophilized RNF41 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405110 Lyophilized RNF41 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417072 Lyophilized RNF41 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405109 Transient overexpression lysate of ring finger protein 41 (RNF41), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY405110 Transient overexpression lysate of ring finger protein 41 (RNF41), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY417072 Transient overexpression lysate of ring finger protein 41 (RNF41), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP307568 Recombinant protein of human ring finger protein 41 (RNF41), transcript variant 2, 20 µg 20 ug
$867.00
TP760790 Purified recombinant protein of Human ring finger protein 41 (RNF41), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products