OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DDAH1 (NM_012137) Human Mass Spec Standard

Be the first to review this product
SKU
PH307548
DDAH1 MS Standard C13 and N15-labeled recombinant protein (NP_036269)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350909 Rabbit Polyclonal Anti-DDAH1 Antibody
100 ul
$205.00
LY402166 Transient overexpression lysate of dimethylarginine dimethylaminohydrolase 1 (DDAH1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "DDAH1 or NM_012137"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207548
Predicted MW 31.1 kDa
Protein Sequence
Protein Sequence
>RC207548 protein sequence
Red=Cloning site Green=Tags(s)

MAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADES
LPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFV
GLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYD
KLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLIN
KKVDS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036269
RefSeq Size 3991
RefSeq ORF 855
Synonyms DDAH; DDAH-1; DDAHI; HEL-S-16
Locus ID 23576
UniProt ID O94760
Cytogenetics 1p22.3
Summary This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DDAH1" proteins (5)
SKU Description Size Price
LC402166 Lyophilized DDAH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427443 Lyophilized DDAH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402166 Transient overexpression lysate of dimethylarginine dimethylaminohydrolase 1 (DDAH1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427443 Transient overexpression lysate of dimethylarginine dimethylaminohydrolase 1 (DDAH1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP307548 Recombinant protein of human dimethylarginine dimethylaminohydrolase 1 (DDAH1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products