OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EVI2A (NM_014210) Human Mass Spec Standard

Be the first to review this product
SKU
PH307538
EVI2A MS Standard C13 and N15-labeled recombinant protein (NP_055025)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA334296 Rabbit Polyclonal Anti-EVI2A Antibody
100 ul
$585.00
LY415446 Transient overexpression lysate of ecotropic viral integration site 2A (EVI2A), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "EVI2A or NM_014210"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207538
Predicted MW 26.2 kDa
Protein Sequence
Protein Sequence
>RC207538 protein sequence
Red=Cloning site Green=Tags(s)

MPTDMEHTGHYLHLAFLMTTVFSLSPGTKANYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDY
KGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNMAMLICLI
IIAVLFLICTFLFLSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLTGPNLVMQ
STGVLTATRERKDEEGTEKLTNKQIG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055025
RefSeq Size 2869
RefSeq ORF 708
Synonyms EVDA; EVI-2A; EVI2
Locus ID 2123
UniProt ID P22794
Cytogenetics 17q11.2
Summary May complex with itself or/and other proteins within the membrane, to function as part of a cell-surface receptor.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EVI2A" proteins (3)
SKU Description Size Price
LC415446 Lyophilized EVI2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415446 Transient overexpression lysate of ecotropic viral integration site 2A (EVI2A), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP307538 Recombinant protein of human ecotropic viral integration site 2A (EVI2A), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products