OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DHDH (NM_014475) Human Mass Spec Standard

Be the first to review this product
SKU
PH307537
DHDH MS Standard C13 and N15-labeled recombinant protein (NP_055290)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365294 DHDH rabbit polyclonal antibody
100 ul
$310.00
LY415257 Transient overexpression lysate of dihydrodiol dehydrogenase (dimeric) (DHDH) (as WB positive control) 100 ug
$436.00

Other products for "DHDH or NM_014475"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207537
Predicted MW 36.4 kDa
Protein Sequence
Protein Sequence
>RC207537 protein sequence
Red=Cloning site Green=Tags(s)

MALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVA
YIGTQHPQHKAAVMLCLAAGKAVLCEKPTGVNAAEVREMVAEARSRALFLMEAIWTRFFPASEALRSVLA
QGTLGDLRVARAEFGKNLIHVPRAVDRAQAGGALLDIGIYCVQFTSMVFGGQKPEKISVVGRRHETGVDD
TVTVLLQYPGEVHGSFTCSITVQLSNTASVSGTKGMVQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFD
NGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAIGVTFPQDKR

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055290
RefSeq Size 1098
RefSeq ORF 1002
Synonyms 2DD; HUM2DD
Locus ID 27294
UniProt ID Q9UQ10
Cytogenetics 19q13.33
Summary This gene encodes an enzyme that belongs to the family of dihydrodiol dehydrogenases, which exist in multiple forms in mammalian tissues and are involved in the metabolism of xenobiotics and sugars. These enzymes catalyze the NADP1-linked oxidation of transdihydrodiols of aromatic hydrocarbons to corresponding catechols. This enzyme is a dimeric dihydrodiol dehydrogenase, and it differs from monomeric dihydrodiol dehydrogenases in its high substrate specificity for trans-dihydrodiols of aromatic hydrocarbons in the oxidative direction. provided by RefSeq, Jul 2008
Protein Pathways Metabolism of xenobiotics by cytochrome P450
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DHDH" proteins (3)
SKU Description Size Price
LC415257 Lyophilized DHDH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415257 Transient overexpression lysate of dihydrodiol dehydrogenase (dimeric) (DHDH) (as WB positive control) 100 ug
$436.00
TP307537 Recombinant protein of human dihydrodiol dehydrogenase (dimeric) (DHDH), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products