OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ASPHD2 (NM_020437) Human Mass Spec Standard

Be the first to review this product
SKU
PH307490
ASPHD2 MS Standard C13 and N15-labeled recombinant protein (NP_065170)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344780 Rabbit Polyclonal Anti-ASPHD2 Antibody - middle region
100 ul
$585.00
LY412486 Transient overexpression lysate of aspartate beta-hydroxylase domain containing 2 (ASPHD2) (as WB positive control) 100 ug
$436.00

Other products for "ASPHD2 or NM_020437"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207490
Predicted MW 38.9 kDa
Protein Sequence
Protein Sequence
>RC207490 protein sequence
Red=Cloning site Green=Tags(s)

MSLEWLVAWSWSLDGLRDCIATGIQSVRDCDTTAVITVACLLVLFVWYCYHVGREQPRPYVSVNSLMQAA
DANGLQNGYVYCQSPECVRCTHNEGLNQKLYHNLQEYAKRYSWSGMGRIHKGIREQGRYLNSRPSIQKPE
VFFLPDLPTTPYFSRDAQKHDVEVLERNFQTILCEFETLYKAFSNCSLPQGWKMNSTPSGEWFTFYLVNQ
GVCVPRNCRKCPRTYRLLGSLRTCIGNNVFGNACISVLSPGTVITEHYGPTNIRIRCHLGLKTPNGCELV
VGGEPQCWAEGRCLLFDDSFLHAAFHEGSAEDGPRVVFMVDLWHPNVAAAERQALDFIFAPGR

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065170
RefSeq Size 3313
RefSeq ORF 1029
Locus ID 57168
UniProt ID Q6ICH7
Cytogenetics 22q12.1
Summary May function as 2-oxoglutarate-dependent dioxygenase.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ASPHD2" proteins (3)
SKU Description Size Price
LC412486 Lyophilized ASPHD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412486 Transient overexpression lysate of aspartate beta-hydroxylase domain containing 2 (ASPHD2) (as WB positive control) 100 ug
$436.00
TP307490 Recombinant protein of human aspartate beta-hydroxylase domain containing 2 (ASPHD2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products