OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C20orf77 (RPRD1B) (NM_021215) Human Mass Spec Standard

Be the first to review this product
SKU
PH307481
RPRD1B MS Standard C13 and N15-labeled recombinant protein (NP_067038)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA381087 RPRD1B Rabbit polyclonal Antibody
100 ul
$410.00
LY412017 Transient overexpression lysate of regulation of nuclear pre-mRNA domain containing 1B (RPRD1B) (as WB positive control) 100 ug
$436.00

Other products for "C20orf77 or NM_021215"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207481
Predicted MW 36.9 kDa
Protein Sequence
Protein Sequence
>RC207481 protein sequence
Red=Cloning site Green=Tags(s)

MSSFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNS
KRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMEDSKSPPPKAT
EEKKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAASGDATVRQKIASLPQEVQD
VSLLEKITDKEAAERLSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKDVLSEKEKKLEEYK
QKLARVTQVRKELKSHIQSLPDLSLLPNVTGGLAPLPSAGDLFSTD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_067038
RefSeq Size 3895
RefSeq ORF 978
Synonyms C20orf77; CREPT; dJ1057B20.2; K-H; Kub5-Hera; NET60
Locus ID 58490
UniProt ID Q9NQG5
Cytogenetics 20q11.23
Summary Interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD by RPAP2. Transcriptional regulator which enhances expression of CCND1. Promotes binding of RNA polymerase II to the CCDN1 promoter and to the termination region before the poly-A site but decreases its binding after the poly-A site. Prevents RNA polymerase II from reading through the 3' end termination site and may allow it to be recruited back to the promoter through promotion of the formation of a chromatin loop. Also enhances the transcription of a number of other cell cycle-related genes including CDK2, CDK4, CDK6 and cyclin-E but not CDKN1A, CDKN1B or cyclin-A. Promotes cell proliferation.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C20orf77" proteins (3)
SKU Description Size Price
LC412017 Lyophilized RPRD1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412017 Transient overexpression lysate of regulation of nuclear pre-mRNA domain containing 1B (RPRD1B) (as WB positive control) 100 ug
$436.00
TP307481 Recombinant protein of human regulation of nuclear pre-mRNA domain containing 1B (RPRD1B), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products