C20orf77 (RPRD1B) (NM_021215) Human Tagged ORF Clone

SKU
RC207481
RPRD1B (Myc-DDK-tagged)-Human regulation of nuclear pre-mRNA domain containing 1B (RPRD1B)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol C20orf77
Synonyms C20orf77; CREPT; dJ1057B20.2; K-H; Kub5-Hera; NET60
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207481 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTCCTTCTCTGAGTCGGCGCTGGAGAAGAAGCTCTCGGAGCTGAGCAACTCTCAGCACAGCGTGC
AGACCCTGTCCCTTTGGCTCATCCACCACCGCAAGCACGCGGGACCCATCGTCTCCGTGTGGCACCGCGA
GCTCCGCAAAGCCAAATCAAATAGAAAGCTTACTTTTCTGTATTTAGCGAATGATGTCATCCAAAACAGT
AAAAGGAAAGGACCTGAATTCACTAGAGAATTTGAATCTGTCCTTGTGGATGCTTTTTCTCATGTTGCCA
GAGAGGCAGATGAAGGCTGTAAAAAACCTTTAGAAAGATTGCTGAACATCTGGCAAGAACGAAGTGTGTA
TGGCGGCGAGTTCATACAGCAGCTGAAGCTGTCTATGGAGGACTCCAAGAGCCCTCCCCCCAAAGCAACA
GAAGAGAAGAAATCTCTGAAACGAACTTTTCAGCAAATTCAGGAGGAGGAGGATGACGACTACCCTGGCA
GCTACTCTCCTCAGGATCCTTCTGCAGGACCCCTCTTGACTGAGGAACTAATCAAAGCTTTGCAGGATCT
GGAAAATGCCGCATCAGGGGATGCTACTGTCCGACAGAAAATTGCTTCTCTGCCCCAGGAAGTGCAAGAT
GTTTCTCTATTGGAAAAAATAACAGACAAAGAGGCAGCTGAACGTCTTTCAAAAACAGTAGATGAAGCAT
GTCTGTTACTAGCAGAATATAACGGGCGCCTGGCAGCAGAACTGGAGGACCGTCGCCAGCTGGCTCGGAT
GTTGGTGGAGTATACCCAGAATCAGAAAGATGTTTTGTCGGAGAAGGAGAAAAAACTAGAGGAATACAAA
CAGAAGCTTGCACGAGTAACCCAGGTCCGCAAGGAACTGAAATCCCATATTCAGAGCTTGCCAGACCTCT
CACTGCTGCCCAACGTCACAGGGGGCTTAGCCCCCCTGCCCTCTGCTGGGGACCTGTTTTCAACTGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207481 protein sequence
Red=Cloning site Green=Tags(s)

MSSFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNS
KRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMEDSKSPPPKAT
EEKKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAASGDATVRQKIASLPQEVQD
VSLLEKITDKEAAERLSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKDVLSEKEKKLEEYK
QKLARVTQVRKELKSHIQSLPDLSLLPNVTGGLAPLPSAGDLFSTD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_021215
ORF Size 978 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021215.4
RefSeq Size 3895 bp
RefSeq ORF 981 bp
Locus ID 58490
UniProt ID Q9NQG5
Cytogenetics 20q11.23
Domains DUF618, RPR
MW 36.9 kDa
Summary Interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD by RPAP2. Transcriptional regulator which enhances expression of CCND1. Promotes binding of RNA polymerase II to the CCDN1 promoter and to the termination region before the poly-A site but decreases its binding after the poly-A site. Prevents RNA polymerase II from reading through the 3' end termination site and may allow it to be recruited back to the promoter through promotion of the formation of a chromatin loop. Also enhances the transcription of a number of other cell cycle-related genes including CDK2, CDK4, CDK6 and cyclin-E but not CDKN1A, CDKN1B or cyclin-A. Promotes cell proliferation.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:C20orf77 (RPRD1B) (NM_021215) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207481L1 Lenti ORF clone of Human regulation of nuclear pre-mRNA domain containing 1B (RPRD1B), Myc-DDK-tagged 10 ug
$600.00
RC207481L2 Lenti ORF clone of Human regulation of nuclear pre-mRNA domain containing 1B (RPRD1B), mGFP tagged 10 ug
$600.00
RC207481L3 Lenti ORF clone of Human regulation of nuclear pre-mRNA domain containing 1B (RPRD1B), Myc-DDK-tagged 10 ug
$600.00
RC207481L4 Lenti ORF clone of Human regulation of nuclear pre-mRNA domain containing 1B (RPRD1B), mGFP tagged 10 ug
$600.00
RG207481 RPRD1B (tGFP-tagged) - Human regulation of nuclear pre-mRNA domain containing 1B (RPRD1B) 10 ug
$500.00
SC112934 RPRD1B (untagged)-Human regulation of nuclear pre-mRNA domain containing 1B (RPRD1B) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.