OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FNDC4 (NM_022823) Human Mass Spec Standard

Be the first to review this product
SKU
PH307471
FNDC4 MS Standard C13 and N15-labeled recombinant protein (NP_073734)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505463 FNDC4 mouse monoclonal antibody,clone OTI1B7 100 ul
$447.00
LY411537 Transient overexpression lysate of fibronectin type III domain containing 4 (FNDC4) (as WB positive control) 100 ug
$436.00

Other products for "FNDC4 or NM_022823"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207471
Predicted MW 25.2 kDa
Protein Sequence
Protein Sequence
>RC207471 protein sequence
Red=Cloning site Green=Tags(s)

MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVP
EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKG
SDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGP
EQSPQGRPVGTRQKKSPSINTIDV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_073734
RefSeq Size 1697
RefSeq ORF 702
Synonyms FRCP1
Locus ID 64838
UniProt ID Q9H6D8
Cytogenetics 2p23.3
Summary Acts as an anti-inflammatory factor in the intestine and colon. Binds to and acts on macrophages to downregulate pro-inflammatory gene expression. Affects key macrophage functions, including phagocytosis, by downregulating many key pathways for macrophage activation, partly via by STAT3 activation and signaling. May be required to dampen the immunological response in colitis.UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FNDC4" proteins (3)
SKU Description Size Price
LC411537 Lyophilized FNDC4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411537 Transient overexpression lysate of fibronectin type III domain containing 4 (FNDC4) (as WB positive control) 100 ug
$436.00
TP307471 Recombinant protein of human fibronectin type III domain containing 4 (FNDC4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products