OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EGFL8 (NM_030652) Human Mass Spec Standard

Be the first to review this product
SKU
PH307461
EGFL8 MS Standard C13 and N15-labeled recombinant protein (NP_085155)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349303 Rabbit Polyclonal Anti-EGFL8 Antibody
100 ul
$205.00
LY410751 Transient overexpression lysate of EGF-like-domain, multiple 8 (EGFL8) (as WB positive control) 100 ug
$436.00

Other products for "EGFL8 or NM_030652"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207461
Predicted MW 32.3 kDa
Protein Sequence
Protein Sequence
>RC207461 protein sequence
Red=Cloning site Green=Tags(s)

MGSRAELCTLLGGFSFLLLLIPGEGAKGGSLRESQGVCSKQTLVVPLHYNESYSQPVYKPYLTLCAGRRI
CSTYRTMYRVMWREVRREVQQTHAVCCQGWKKRHPGALTCEAICAKPCLNGGVCVRPDQCECAPGWGGKH
CHVDVDECRTSITLCSHHCFNTAGSFTCGCPHDLVLGVDGRTCMEGSPEPPTSASILSVAVREAEKDERA
LKQEIHELRGRLERLEQWAGQAGAWVRAVLPVPPEELQPEQVAELWGRGDRIESLSDQVLLLQERLGACS
CEDNSLGLGVNHR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_085155
RefSeq Size 1311
RefSeq ORF 879
Synonyms C6orf8; NG3
Locus ID 80864
UniProt ID Q99944
Cytogenetics 6p21.32
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EGFL8" proteins (3)
SKU Description Size Price
LC410751 Lyophilized EGFL8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410751 Transient overexpression lysate of EGF-like-domain, multiple 8 (EGFL8) (as WB positive control) 100 ug
$436.00
TP307461 Recombinant protein of human EGF-like-domain, multiple 8 (EGFL8), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products