OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PPIL6 (NM_173672) Human Mass Spec Standard

Be the first to review this product
SKU
PH307244
PPIL6 MS Standard C13 and N15-labeled recombinant protein (NP_775943)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504846 PPIL6 mouse monoclonal antibody, clone OTI4F2 (formerly 4F2) 100 ul
$447.00
LY406551 Transient overexpression lysate of peptidylprolyl isomerase (cyclophilin)-like 6 (PPIL6), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "PPIL6 or NM_173672"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207244
Predicted MW 35.2 kDa
Protein Sequence
Protein Sequence
>RC207244 protein sequence
Red=Cloning site Green=Tags(s)

MARPQPCGPPHARCGSPSLPERPLQVKVVGLFSCPNFQIAKSAAENLKNNHPSKFEDPILVPLQEFAWHQ
YLQEKKRELKNETWEYSSSVISFVNGQFLGDALDLQKWAHEVWDIVDIKPSALYDALTEDFSAKFLRDTK
HDFVFLDICIDSSPIGRLIFELYCDVCPKTCKNFQVLCTGKAGFSQRGIRLHYKNSIFHRIVQNGWIQGG
DIVYGKGDNGESIYGPTFEDENFSVPHNKRGVLGMANKGRHSNGSQFYITLQATPYLDRKFVAFGQLIEG
TEVLKQLELVPTQNERPIHMCRITDSGDPYA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_775943
RefSeq Size 4145
RefSeq ORF 933
Synonyms bA425D10.6; dJ919F19.1; PPIase; RSPH12
Locus ID 285755
UniProt ID Q8IXY8
Cytogenetics 6q21
Summary Probable inactive PPIase with no peptidyl-prolyl cis-trans isomerase activity.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PPIL6" proteins (5)
SKU Description Size Price
LC406551 Lyophilized PPIL6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426361 Lyophilized PPIL6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406551 Transient overexpression lysate of peptidylprolyl isomerase (cyclophilin)-like 6 (PPIL6), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426361 Transient overexpression lysate of peptidylprolyl isomerase (cyclophilin)-like 6 (PPIL6), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP307244 Recombinant protein of human peptidylprolyl isomerase (cyclophilin)-like 6 (PPIL6), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products