OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BATF (NM_006399) Human Mass Spec Standard

Be the first to review this product
SKU
PH307104
BATF MS Standard C13 and N15-labeled recombinant protein (NP_006390)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365508 BATF rabbit polyclonal antibody
100 ul
$310.00
LY416664 Transient overexpression lysate of basic leucine zipper transcription factor, ATF-like (BATF) (as WB positive control) 100 ug
$436.00

Other products for "BATF or NM_006399"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207104
Predicted MW 14.1 kDa
Protein Sequence
Protein Sequence
>RC207104 protein sequence
Red=Cloning site Green=Tags(s)

MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRK
EIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006390
RefSeq Size 953
RefSeq ORF 375
Synonyms B-ATF; BATF1; SFA-2; SFA2
Locus ID 10538
UniProt ID Q16520
Cytogenetics 14q24.3
Summary The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events. provided by RefSeq, Jul 2008
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BATF" proteins (3)
SKU Description Size Price
LC416664 Lyophilized BATF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416664 Transient overexpression lysate of basic leucine zipper transcription factor, ATF-like (BATF) (as WB positive control) 100 ug
$436.00
TP307104 Recombinant protein of human basic leucine zipper transcription factor, ATF-like (BATF), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products