PDP2 (NM_020786) Human Mass Spec Standard

CAT#: PH307071

PDP2 MS Standard C13 and N15-labeled recombinant protein (NP_065837)

Product Images

Coomassie blue staining of purified PDP2 protein (Cat# TP307071). The protein was produced from HEK293T cells transfected with PDP2 cDNA clone (Cat# RC207071) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207071
• Predicted MW: 60 kDa
• Protein Sequence:
  Sequence Link

  >RC207071 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSTVSYWILNSTRNSIATLQGGRRLYSRYVSNRNKLKWRLFSRVPPTLNSSPCGGFTLCKAYRHTSTEE
  DDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSPVEDRRGVASCLQTNGLMFGIF
  DGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESMKPLLPILHWLKHPGDSIYKDVTSVHLDHLR
  VYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVDGIHLH
  VANAGDCRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMEDRLLGVLIPCRAFGD
  VQLKWSKELQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDMLSN
  EDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYGEMEAE
  RLAAMLTLPEDLARMYRDDITVTVVYFNSESIGAYYKGG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065837
• RefSeq Size: 7042
• RefSeq ORF: 1587
• Synonyms: PDPC 2; PPM2B; PPM2C2
• Locus ID: 57546
• UniProt ID: Q9P2J9
• Cytogenetics: 16q22.1
• Summary: This gene is a mitochondrial protein that functions as a phosphatase and is involved in the enzymatic resetting of the pyruvate dehydrogenase complex. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Aug 2016]
• Protein Families: Druggable Genome, Phosphatase