OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD93 (NM_012072) Human Mass Spec Standard

Be the first to review this product
SKU
PH306980
CD93 MS Standard C13 and N15-labeled recombinant protein (NP_036204)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA322420 Anti-CD93 Rabbit Polyclonal Antibody
100 ul
$305.00
LY415997 Transient overexpression lysate of CD93 molecule (CD93) (as WB positive control) 100 ug
$436.00

Other products for "CD93 or NM_012072"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206980
Predicted MW 68.6 kDa
Protein Sequence
Protein Sequence
>RC206980 protein sequence
Red=Cloning site Green=Tags(s)

MATSMGLLLLLLLLLTQPGAGTGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQ
HVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKR
CVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSS
SLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGD
GSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQ
DSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGE
DGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKE
GSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQE
PAGGDSSVATQNNDGTDGQKLLLFYILGTVVAILLLLALALGLLVYRKRRAKREEKKEKKPQNAADSYSW
VPERAESRAMENQYSPTPGTDC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036204
RefSeq Size 6701
RefSeq ORF 1956
Synonyms C1qR(P); C1QR1; C1qRP; CDw93; dJ737E23.1; ECSM3; MXRA4
Locus ID 22918
UniProt ID Q9NPY3
Cytogenetics 20p11.21
Summary The protein encoded by this gene is a cell-surface glycoprotein and type I membrane protein that was originally identified as a myeloid cell-specific marker. The encoded protein was once thought to be a receptor for C1q, but now is thought to instead be involved in intercellular adhesion and in the clearance of apoptotic cells. The intracellular cytoplasmic tail of this protein has been found to interact with moesin, a protein known to play a role in linking transmembrane proteins to the cytoskeleton and in the remodelling of the cytoskeleton. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD93" proteins (4)
SKU Description Size Price
LC415997 Lyophilized CD93 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415997 Transient overexpression lysate of CD93 molecule (CD93) (as WB positive control) 100 ug
$436.00
TP306980 Recombinant protein of human CD93 molecule (CD93), 20 µg 20 ug
$867.00
TP720347 Recombinant protein of human CD93 molecule (CD93) 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products