OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DUSP28 (NM_001033575) Human Mass Spec Standard

Be the first to review this product
SKU
PH306912
DUSP28 MS Standard C13 and N15-labeled recombinant protein (NP_001028747)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY422400 Transient overexpression lysate of dual specificity phosphatase 28 (DUSP28) (as WB positive control) 100 ug
$436.00

Other products for "DUSP28 or NM_001033575"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206912
Predicted MW 18.3 kDa
Protein Sequence
Protein Sequence
>RC206912 protein sequence
Red=Cloning site Green=Tags(s)

MGPAEAGRRGAASPVPPPLVRVAPSLFLGSARAAGAEEQLARAGVTLCVNVSRQQPGPRAPGVAELRVPV
FDDPAEDLLAHLEPTCAAMEAAVRAGGACLVYCKNGRSRSAAVCTAYLMRHRGLSLAKAFQMVKSARPVA
EPNPGFWSQLQKYEEALQAQSCLQGEPPALGLGPEA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001028747
RefSeq Size 1555
RefSeq ORF 528
Synonyms DUSP26; VHP
Locus ID 285193
UniProt ID Q4G0W2
Cytogenetics 2q37.3
Summary Has phosphatase activity with the synthetic substrate 6,8-difluoro-4-methylumbelliferyl phosphate (in vitro) (PubMed:24531476, PubMed:29121083). Has almost no detectable activity with phosphotyrosine, even less activity with phosphothreonine and displays complete lack of activity with phosphoserine (PubMed:29121083). The poor activity with phosphotyrosine may be due to steric hindrance by bulky amino acid sidechains that obstruct access to the active site (PubMed:29121083).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DUSP28" proteins (3)
SKU Description Size Price
LC422400 Lyophilized DUSP28 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422400 Transient overexpression lysate of dual specificity phosphatase 28 (DUSP28) (as WB positive control) 100 ug
$436.00
TP306912 Recombinant protein of human dual specificity phosphatase 28 (DUSP28), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products