OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CYTL1 (NM_018659) Human Mass Spec Standard

Be the first to review this product
SKU
PH306778
CYTL1 MS Standard C13 and N15-labeled recombinant protein (NP_061129)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA315520 Rabbit polyclonal anti-CYTL1 antibody
100 ul
$380.00
LY412966 Transient overexpression lysate of cytokine-like 1 (CYTL1) (as WB positive control) 100 ug
$436.00

Other products for "CYTL1 or NM_018659"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206778
Predicted MW 15.6 kDa
Protein Sequence
Protein Sequence
>RC206778 protein sequence
Red=Cloning site Green=Tags(s)

MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCV
LDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061129
RefSeq Size 1019
RefSeq ORF 408
Synonyms C4orf4; C17
Locus ID 54360
UniProt ID Q9NRR1
Cytogenetics 4p16.2
Summary C17 is a cytokine-like protein specifically expressed in bone marrow and cord blood mononuclear cells that bear the CD34 (MIM 142230) surface marker (Liu et al., 2000 PubMed 10857752).supplied by OMIM, Mar 2008
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CYTL1" proteins (3)
SKU Description Size Price
LC412966 Lyophilized CYTL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412966 Transient overexpression lysate of cytokine-like 1 (CYTL1) (as WB positive control) 100 ug
$436.00
TP306778 Recombinant protein of human cytokine-like 1 (CYTL1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products