CYTL1 (NM_018659) Human Tagged ORF Clone

SKU
RC206778
CYTL1 (Myc-DDK-tagged)-Human cytokine-like 1 (CYTL1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CYTL1
Synonyms C4orf4; C17
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206778 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGACGCCTGGGCCTCTGCCCGTGCTGCTGCTGCTCCTGGCGGGAGCCCCCGCCGCGCGGCCCACTC
CCCCGACCTGCTACTCCCGCATGCGGGCCCTGAGCCAGGAGATCACCCGCGACTTCAACCTCCTGCAGGT
CTCGGAGCCCTCGGAGCCATGTGTGAGATACCTGCCCAGGCTGTACCTGGACATACACAATTACTGTGTG
CTGGACAAGCTGCGGGACTTTGTGGCCTCGCCCCCGTGTTGGAAAGTGGCCCAGGTAGATTCCTTGAAGG
ACAAAGCACGGAAGCTGTACACCATCATGAACTCGTTCTGCAGGAGAGATTTGGTATTCCTGTTGGATGA
CTGCAATGCCTTGGAATACCCAATCCCAGTGACTACGGTCCTGCCAGATCGTCAGCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206778 protein sequence
Red=Cloning site Green=Tags(s)

MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCV
LDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018659
ORF Size 408 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018659.3
RefSeq Size 1019 bp
RefSeq ORF 411 bp
Locus ID 54360
UniProt ID Q9NRR1
Cytogenetics 4p16.2
Protein Families Druggable Genome, Secreted Protein
MW 15.6 kDa
Summary C17 is a cytokine-like protein specifically expressed in bone marrow and cord blood mononuclear cells that bear the CD34 (MIM 142230) surface marker (Liu et al., 2000 [PubMed 10857752]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:CYTL1 (NM_018659) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206778L1 Lenti ORF clone of Human cytokine-like 1 (CYTL1), Myc-DDK-tagged 10 ug
$450.00
RC206778L2 Lenti ORF clone of Human cytokine-like 1 (CYTL1), mGFP tagged 10 ug
$450.00
RC206778L3 Lenti ORF clone of Human cytokine-like 1 (CYTL1), Myc-DDK-tagged 10 ug
$450.00
RC206778L4 Lenti ORF clone of Human cytokine-like 1 (CYTL1), mGFP tagged 10 ug
$450.00
RG206778 CYTL1 (tGFP-tagged) - Human cytokine-like 1 (CYTL1) 10 ug
$489.00
SC122877 CYTL1 (untagged)-Human cytokine-like 1 (CYTL1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.